PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN05181.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 354aa    MW: 39463.9 Da    PI: 7.5677
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN05181.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.82.2e-174390148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEde l++++k+ G g+W+t +++ g+ R++k+c++rw +yl
       KHN05181.1 43 RGPWTPEEDEVLANYIKKEGEGRWRTLPKRAGLLRCGKSCRLRWMNYL 90
                     89******************************99************97 PP

2Myb_DNA-binding46.68.1e-15101141648
                      HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      ++E++l+++++++lG++ W++Ia +++ gRt++++k++w+++l
       KHN05181.1 101 PDEEDLILRLHRLLGNR-WSLIAGRIP-GRTDNEIKNYWNTHL 141
                      89***************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.7E-223492IPR009057Homeodomain-like
PROSITE profilePS5129416.3223890IPR017930Myb domain
SuperFamilySSF466896.6E-2940137IPR009057Homeodomain-like
SMARTSM007178.4E-134292IPR001005SANT/Myb domain
PfamPF002494.2E-154390IPR001005SANT/Myb domain
CDDcd001677.08E-114590No hitNo description
PROSITE profilePS5129424.40491145IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.9E-2493146IPR009057Homeodomain-like
SMARTSM007171.2E-1395143IPR001005SANT/Myb domain
CDDcd001671.35E-11101141No hitNo description
PfamPF002491.3E-13101141IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0010468Biological Processregulation of gene expression
GO:0048354Biological Processmucilage biosynthetic process involved in seed coat development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MRNPSSTTTT AATTTTKTKV KNNSNNNIGS NNSPCCNKVG LKRGPWTPEE DEVLANYIKK  60
EGEGRWRTLP KRAGLLRCGK SCRLRWMNYL RPSVKRGHIA PDEEDLILRL HRLLGNRWSL  120
IAGRIPGRTD NEIKNYWNTH LSKKLISQGI DPRTHKPLNP ASINVPSSST TSSKPLPMII  180
TNNHINPVHH DLTNMFNQGV HQVHHLGQHH HQPPASNPYD NHNPVPAAAT GDVSAMAFMD  240
NNNEDCNDDI NINYYSDDVF SSFLNSLIND DAFAAQQHHV QTEIPTPSER SIMNPLPCDD  300
RVGGHLGSIA TASAAQGYDD ELGVLWESPL VNAATFSQHV DDHITKRVHD HHNQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-25411455108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB5979330.0AB597933.1 Glycine max W2 mRNA for R2R3 MYB transcription factor, complete cds, cultivar: Nezumisaya.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006593823.10.0PREDICTED: transcription repressor MYB5-like
SwissprotQ388504e-85MYB5_ARATH; Transcription repressor MYB5
TrEMBLA0A0B2P7J70.0A0A0B2P7J7_GLYSO; Transcription repressor MYB5
TrEMBLK7LY690.0K7LY69_SOYBN; Uncharacterized protein
STRINGGLYMA13G09980.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38943064
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.16e-78myb domain protein 5
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]